| Catalog | name | Description | price |
|---|---|---|---|
| R-C-7199 | DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) | DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) . Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,Used to achieve targeted delivery or other functions. | price> |
| R-C-7200 | DMPE-PEG-KYIKFKHDYNILEFNDGTFE-K-FI | DMPE is a phospholipid molecule containing myristoyl and phosphatidylcholine.The hydrophobic chain of DMPE facilitates its embedding in biological membranes or liposomes,enhancing the binding between molecules and membranes.PEG is a hydrophilic polymer used to increase the water solubility and biocompatibility of molecules.PEG has good flexibility,which can improve the solubility and stability of molecules,and reduce non-specific binding.It can couple various peptides(KYIKFKHDYNILEFNDGTFE-K-FI) and small molecule groups. | price> |
| R-C-5621 | DSPE-PEG2000-TFFYGGSRGKRNNFKTEEY | The peptide sequence Angiopep-2 (TFFYGGSRGKRNNFKTEEYC) is a specific targeting peptide derived from the protein fibronectin. This peptide is known to have affinity for certain receptors or molecules present on the surface of specific cell types. By conjugating this peptide to DSPE-PEG2000, the liposomes or nanoparticles can potentially target and bind to the corresponding receptors on specific cells. | price> |
| R-C-7201 | DSPE-TK-PEG-CSTSMLKAC | DSPE-TK-PEG-CTSSMLKAC is a ROS responsive nanomaterial that combines phospholipids,polyethylene glycol(PEG),and cardiac targeting peptides(CSTSMLKAC).It has targeted delivery and controlled release functions and is mainly used in the treatment of myocardial diseases or drug delivery systems Thioketal is a ROS responsive linker that can be cleaved in high reactive oxygen species(ROS)environments,enabling controlled drug release. | price> |
| R-C-5622 | DSPE-PEG2000-CLSSRLDAC | DSPE(1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a phospholipid that can integrate into the lipid bilayer of liposomes or nanoparticles.PEG2000 refers to the attachment of a polyethylene glycol (PEG) polymer chain of approximately 2000 Daltons in size,providing stealth properties to the formulation and increasing its circulation time in the bloodstream.The peptide sequence CLSSRLDAC is a specific targeting peptide with affinity for certain receptors or molecules present on the surface of specific cells.By conjugating this peptide to DSPE-PEG2000,the liposomes or nanoparticles can potentially target and bind to the corresponding receptors on specific cells. | price> |
| R-C-5623 | DSPE-PEG2000-CLPVASC | DSPE-PEG-KPT,CLPVASC named the kidney targeting peptide(KTP),and demonstrated kidney accumulation that is 5-fold higher than an untargeted ELP and 5-fold higher compared to other peripheral organs in swine.Intrarenal distribution showed association of this KTP ELP around the glomerulus and surrounding proximal and distal tubules.Use CLPVASC,an elastin-like polypeptide, to achieve glomerular endothelial cell barrier and basement membrane targeting. | price> |
| R-C-7203 | DLPE-PEG-NTA-Ni | NTA-Ni-PEG-DLPE,1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine(DLPE)is an important phospholipid compound.As a component analog of cell membranes,it can be used to construct artificial liposomes,simulate the properties and functions of biological membranes,and help study the interactions between membrane proteins and membranes.NTA is a metal ion chelating ligand that is particularly suitable for forming stable complexes with nickel ions(Ni). | price> |
| R-C-5624 | DSPE-PEG2K-CPLGLAG-GGYTFHWHRLNP | DSPE-PEG2K-CPLGLAG-GGYTFHWHRLNP,(DSPE) polyethyleneglycol is a combination of phospholipid and polyethylene glycol,which has hydrophilicity and hydrophobicity.Polyethylene glycol liposomes were used to form high-quality materials.It can be used for drug delivery,gene transfection and vaccine delivery.We can also customize various products with different molecular weights. | price> |
| R-C-7204 | DPPE-PEG-NTA-Ni | NTA-Ni-PEG-DPPE,DPPE-PEG-NTA-Ni is a modular amphiphilic molecule used mainly for His-tag protein capture,membrane functionalization,or nanoparticle surface modification.NTA is a metal ion chelating ligand that is particularly suitable for forming stable complexes with nickel ions(Ni). | price> |
| R-C-5625 | DSPE-PEG2K-CPLG | DSPE-PEG-CPLG,DSPE is a phospholipid that can be embedded in the lipid bilayer of liposomes or nanoparticles.Its combination with PEG alters the characteristics of liposomes or nanoparticles,providing stability and enhanced solubility,and prolonging the circulation time of the delivery system in the body. Lecithin (phosphatidylcholine) is a common lipid mainly present in biological cell membranes and plays a crucial role in maintaining cell health and function. In DSPE-PEG lecithin, it may serve as one of the main components, helping to construct a lipid bilayer structure of liposomes or nanoparticles. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


