| Catalog | name | Description | price |
|---|---|---|---|
| R-C-5756 | DSPE-PEG2000-SKPPGTSSC (SKP) | DSPE-PEG-SKPPGTSSC (SKP),DSPE is a phospholipid that is commonly used in the formulation of liposomes or lipid-based drug delivery systems.PEG is a hydrophilic polymer that is often conjugated to molecules to enhance their stability, increase solubility, and extend circulation time in the body. PEGylation can improve the bioavailability and reduce the immunogenicity of drug delivery systems.DSPE-PEG-SKPPGTSSC can be modified to incorporate additional functionalities or payloads, such as fluorescent dyes or therapeutic agents, to enable targeted and specific delivery to desired cells or tissues. | price> |
| R-C-5759 | DSPE-PEG2000-Peptide-22(Ac-C(&)MPRLRGC(&)-NH2) | Phospholipid polyethylene glycol peptides are a type of commonly used nano delivery system materials in the biomedical field. They are typically composed of phosphatidylcholine, polyethylene glycol, and peptides with specific affinity. Among them, phosphatidylcholine can provide structural support and targeted carriers, while polyethylene glycol can increase the cycling time and biocompatibility of the material in vivo, reduce its immunogenicity, and peptide sequences can provide specific binding and targeting to specific target molecules. | price> |
| R-C-5760 | DSPE-PEG2000-THR | DSPE-PEG-threonine,DSPE is a phospholipid commonly used in the formulation of liposomes or lipid-based drug delivery systems. It provides stability and allows for integration into the lipid bilayer.PEG is a hydrophilic polymer that is often conjugated to molecules to enhance their stability, increase solubility, and extend circulation time in the body.THR or threonine, is an amino acid.Threonine is a polar amino acid that is often found in the active sites of enzymes and can play a role in protein structure and function. | price> |
| R-C-5765 | DSPE-PEG-5HT | DSPE-PEG-5-hydroxytryptamine,The DSPE-PEG-5-hydroxytryptamine nanoparticle formulation can be utilized in various biomedical applications. For example, it could be used for targeted drug delivery, where the nanoparticles encapsulate therapeutic agents and specifically deliver them to cells expressing serotonin receptors. Additionally, the formulation could also be used for diagnostic purposes by incorporating imaging agents, allowing for targeted imaging of specific tissues or cells. | price> |
| R-C-7249 | DSPE-PEG-HA-fitc | This product uses DSPE as the hydrophobic anchoring end, and its two octadecyl chains can be stably embedded into the lipid bilayer structure of liposomes or cell membranes; The middle segment is a hydrophilic PEG chain,with HA serving as the biological recognition end,coupled with the amino group at the PEG end through carboxyl groups. Its polysaccharide structure can specifically bind to cell surface receptors(such as CD44), while FITC serves as a fluorescent tracer group,fixed to the HA or PEG end through covalent bonds,providing a green fluorescence signal(excitation wavelength of about 488 nm,emission wavelength of about 520 nm). | price> |
| R-C-5770 | (ASPSerser6)DSPE-PEG2000-COOH | DSPE-PEG(2000) Carboxylic Acid,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-PEG-succinic acid (DSPE-PEG-COOH), (or N-succinyl-L-α-phosphatidylethanolamine, Distearoyl) is a DSPE-PEG conjugate with carboxylic acid group at the end of PEG. DSPE-PEG-COOH is used to prepare long-circulating liposomes with free COOH on the surface for further modification of peptides and other functional groups (ASPSserser6). This product is only suitable for scientific research and does not require clinical or human experimentation. | price> |
| R-C-7250 | DSPE-PEG-TK-β-CD | DSPE-PEG-TK is an amphiphilic phospholipid polymer with oxidative response properties, widely used in targeted drug delivery systems.It is mainly composed of phospholipid structure,polyethylene glycol chain,and ketothiol responsive bonds,which can achieve intelligent drug release in the tumor microenvironment.Β-CD(β-cyclodextrin)is a cyclic oligosaccharide composed of 7 glucose units connected by α-1,4-glycosidic bonds, forming a hydrophobic cavity that can encapsulate hydrophobic drugs or guest molecules. | price> |
| R-C-5771 | DSPE-PEG2000-CLP003 | DSPE-PEG-CLP003,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.This product is only suitable for scientific research and does not require clinical or human experimentation. | price> |
| R-C-5772 | DSPE-PEG2000-CLP003-FITC | DSPE-PEG-CLP003-FITC,CLP002 and CLP003 were discovered against human PD-L1 protein and therefore may have less binding affinity to mouse PD-L1 or less overlap with the mouse PD-1/PD-L1 interaction residues.FITC is a commonly used fluorescent dye that emits green fluorescence when excited by a specific wavelength of light. By attaching FITC to the DSPE-PEG2000-CLP003 conjugate, it allows for visualization and tracking of the conjugate in biological systems.This product is only suitable for scientific research and does not require clinical or human experimentation. | price> |
| R-C-5778 | DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT | DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


