| Catalog | name | Description | price |
|---|---|---|---|
| R-C-5778 | DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT | DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. | price> |
| R-C-5789 | DSPE-PEG2000-KKKKKKKKKK | DSPE-PEG-KKKKKKKKKK,DSPE is a phospholipid that can integrate into lipid bilayers due to its hydrophobic and hydrophilic regions.PEG is a polymer that is often attached to lipid molecules to improve their stability,biocompatibility,and circulation time in biological systems.The lysine repeat (KKKKKKKKKK) is a peptide sequence that can interact with negatively charged molecules,such as DNA or RNA,through electrostatic interactions. | price> |
| R-C-7373 | DSPE-PEG-Brown algae polysaccharide | DSPE-PEG-Brown Algae Polysaccharide is an amphiphilic functionalized conjugate that covalently links natural active polysaccharides with synthetic high molecular weight phospholipids.It combines the self-assembly ability of lipids,the stability of PEG,and the biological activity of brown algae polysaccharides,demonstrating unique potential in the fields of intelligent drug delivery and targeted therapy.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-5795 | mPEG2K-SS-PEI1.8K-DPSE | DPSE-PEI-SS-MPEG,MPEG-SS-PEI-DPSE is a commonly used construct for gene vectors and drug loaded nanoparticles in the biomedical field.In this compound,the mPEG and SS functional groups provide biocompatibility and stability.The presence of PEI can cause it to condense with negatively charged biological molecules such as DNA,making it a gene carrier. | price> |
| R-C-7375 | DSPE-PEG-CSKSSDYQC | CSKSSDYQC-PEG-DSPE,DSPE-PEG-CSKSSDYQC is a functional molecule that covalently links the goblet cell targeting peptide CSKSSDYQC with phospholipid polyethylene glycol(DSPE-PEG).The molecule is embedded into a liposome or nanoparticle membrane structure through the hydrophobic tail of DSPE,and PEG acts as a hydrophilic spacer arm to enhance colloid stability and prolong circulation time.The exposed CSKSSDYQC peptide segment is responsible for recognizing and binding to M cells or goblet cell surface receptors in Peyers patches of the intestine.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-5797 | DSPE-PEG2000-OCH3 | DSPE-PEG-OCH3,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems such as liposomes and lipid nanoparticles.PEGylation can improve the stability and circulation time of the nanoparticles by reducing interactions with proteins and immune recognition.This can lead to improved drug delivery efficiency and reduced clearance rates.The methoxy group (-OCH3) at the end of the PEG chain in DSPE-PEG-OCH3 is often used as a spacer between the nanoparticle surface and any targeting ligands or functional moieties that may be attached. The methoxy group can provide flexibility and prevent steric hindrance, allowing for effective conjugation of targeting ligands or other molecules. | price> |
| R-C-7378 | DSPE-TK-PEG-CAQK | CAQK-PEG-TK-DSPE,DSPE-TK-PEG-CAQK is a multifunctional intelligent responsive lipid polymer copolymer that has shown great potential in tumor targeted therapy,nerve injury repair,and nucleic acid drug delivery.This material achieves precise and efficient drug delivery through three major mechanisms:ROS responsive release,long cycling characteristics, and tissue-specific targeting.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-5800 | DSPE-PEG2K-PBP(CDAEWVDVS) | DSPE-PEG-PBP,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems,providing stability and structure to the nanoparticles.PEGylation involves attaching PEG chains to the molecule,offering improved stability, circulation time, and reduced immunogenicity.The peptide sequence PBP(CDAEWVDVS) is attached to the PEG chain. | price> |
| R-C-7380 | DSPE-PEG-SFHQFARATLAS | SFHQFARATLAS-PEG-DSPE,DSPE-PEG-HAP-1,DSPE-PEG-HAP-1 can be used as a modular tool to further couple mRNA, protein drugs,or immunomodulators,expanding to the development of intelligent treatment systems for autoimmune diseases,osteoarthritis, and other fields.The uniqueness of HAP-1 peptide lies in its combination of targeting and penetration properties,unlike ordinary ligands that can only bind to surface receptors.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-5801 | DSPE-PEG2K-VHPKQHR | DSPE-PEG-VHPKQHR,By adding a cysteine group to the N-terminus of VHPKQHR peptide, a VCAM-1-binding peptide derived from phage display in vivo85,the linkage of CVHPKQHR to distearoyl phosphoethanolamine-poly(ethylene glycol) 2000-maleimide (DSPE-PEG2000-maleimide) was facilitated through thioether linkage,forming DSPE-PEG2000-VHPKQHR. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


